VMAT1 (SLC18A1) Rabbit Polyclonal Antibody
CAT#: TA344468
Rabbit Polyclonal Anti-SLC18A1 Antibody - N-terminal region
Need it in bulk or conjugated?
Get a free quote
CNY 4628.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-SLC18A1 antibody is: synthetic peptide directed towards the N-terminal region of Human SLC18A1. Synthetic peptide located within the following region: FKEVNSSLHLGHAGSSPHALASPAFSTIFSFFNNNTVAVEESVPSGIAWM |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 42 kDa |
Gene Name | solute carrier family 18 member A1 |
Database Link | |
Background | The vesicular monoamine transporter acts to accumulate cytosolic monoamines into vesicles, using the proton gradient maintained across the vesicular membrane. Its proper function is essential to the correct activity of the monoaminergic systems that have been implicated in several human neuropsychiatric disorders. The transporter is a site of action of important drugs, including reserpine and tetrabenazine. |
Synonyms | CGAT; VAT1; VMAT1 |
Note | Immunogen Sequence Homology: Human: 100%; Bovine: 100%; Pig: 92%; Dog: 77%; Horse: 77% |
Reference Data | |
Protein Families | Transmembrane |
Protein Pathways | Parkinson's disease |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |