ARA9 (AIP) Rabbit Polyclonal Antibody

CAT#: TA344442

Rabbit Polyclonal Anti-AIP Antibody - middle region



Need it in bulk or conjugated?
Get a free quote

CNY 4628.00


货期*
2周

规格
    • 50 ug

Product images

推荐一起购买 (4)
Transient overexpression lysate of aryl hydrocarbon receptor interacting protein (AIP)
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human aryl hydrocarbon receptor interacting protein (AIP), 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Recombinant protein of human aryl hydrocarbon receptor interacting protein (AIP), 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-AIP antibody: synthetic peptide directed towards the middle region of human AIP. Synthetic peptide located within the following region: NAQEAQADFAKVLELDPALAPVVSRELQALEARIRQKDEEDKARFRGIFS
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 38 kDa
Gene Name aryl hydrocarbon receptor interacting protein
Background The protein encoded by this gene is a receptor for aryl hydrocarbons and a ligand-activated transcription factor. The encoded protein is found in the cytoplasm as part of a multiprotein complex, but upon binding of ligand is transported to the nucleus. This protein can regulate the expression of many xenobiotic metabolizing enzymes. Also, the encoded protein can bind specifically to and inhibit the activity of hepatitis B virus.
Synonyms ARA9; FKBP16; FKBP37; SMTPHN; XAP-2; XAP2
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Mouse: 93%; Guinea pig: 79%
Reference Data
Protein Families Druggable Genome, Transcription Factors
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...