TFDP3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TFDP3 antibody: synthetic peptide directed towards the N terminal of human TFDP3. Synthetic peptide located within the following region: PVVGSPNPPSTHFASQNQHSYSSPPWAGQHNRKGEKNGMGLCRLSMKVWE
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	38 kDa
Gene Name	transcription factor Dp family member 3
Database Link	NP_057605 Entrez Gene 51270 Human UniProt ID Q5H9I0
Background	The specific function of the protein remains unknown.
Synonyms	CT30; DP4; HCA661
Note	Immunogen Sequence Homology: Human: 100%; Rabbit: 79%; Pig: 77%; Rat: 77%; Guinea pig: 77%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.