CCDC74A Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CCDC74A antibody: synthetic peptide directed towards the middle region of human CCDC74A. Synthetic peptide located within the following region: FPKVSTKSLSKKCLSPPVAERAILPALKQTPKNNFAERQKRLQAMQKRRL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	42 kDa
Gene Name	coiled-coil domain containing 74A
Database Link	NP_620125 Entrez Gene 90557 Human UniProt ID Q96AQ1
Background	The exact function of CCDC74A remains unknown.
Synonyms	CCDC74AV2; CCDC74AV3; FLJ40345
Note	Immunogen Sequence Homology: Human: 100%; Horse: 93%; Mouse: 86%; Rabbit: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.