SPFH2 (ERLIN2) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ERLIN2 antibody: synthetic peptide directed towards the middle region of human ERLIN2. Synthetic peptide located within the following region: ASNSKIYFGKDIPNMFMDSAGSVSKQFEGLADKLSFGLEDEPLETATKEN
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	38 kDa
Gene Name	ER lipid raft associated 2
Database Link	NP_009106 Entrez Gene 11160 Human UniProt ID O94905
Background	ERLIN2 plays an important role in the early steps of the endoplasmic reticulum-associated degradation (ERAD) pathway. It is involved in ITPR1 degradation by the ERAD pathway.
Synonyms	C8orf2; Erlin-2; NET32; SPFH2; SPG18
Note	Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Rat: 93%; Mouse: 86%; Pig: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.