SNT2 (FRS3) Rabbit Polyclonal Antibody
CAT#: TA344327
Rabbit Polyclonal Anti-FRS3 Antibody - C-terminal region
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Mouse |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-Frs3 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Frs3. Synthetic peptide located within the following region: APGPTPHPVRSSDSYAVIDLKKTAAMSDLQRALPRDDGAVRKTRHNSTDL |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 54 kDa |
Gene Name | fibroblast growth factor receptor substrate 3 |
Database Link | |
Background | Frs3 is an adapter protein that links FGR and NGF receptors to downstream signaling pathways. It is involved in the activation of MAP kinases. Frs3 Down-regulates ERK2 signaling by interfering with the phosphorylation and nuclear translocation of ERK2. |
Synonyms | FRS2-beta; FRS2B; FRS2beta; SNT-2; SNT2 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100% |
Reference Data | |
Protein Families | Druggable Genome |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |