MS4A4A Rabbit Polyclonal Antibody
CAT#: TA344314
Rabbit Polyclonal Anti-MS4A4A Antibody - N-terminal region
Need it in bulk or conjugated?
Get a free quote
CNY 5200.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
| Product Data | |
| Applications | WB |
| Recommend Dilution | WB |
| Reactivity | Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-MS4A4A antibody: synthetic peptide directed towards the N terminal of human MS4A4A. Synthetic peptide located within the following region: MHQTYSRHCRPEESTFSAAMTTMQGMEQAMPGAGPGVPQLGNMAVIHSHL |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 26 kDa |
| Gene Name | membrane spanning 4-domains A4A |
| Database Link | |
| Background | MS4A4A is a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues.This gene encodes a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. Alternative splicing of this gene results in several transcript variants; however, not all transcripts have been fully described. |
| Synonyms | 4SPAN1; CD20-L1; CD20L1; HDCME31P; MS4A4; MS4A7 |
| Note | Immunogen Sequence Homology: Human: 100%; Rat: 86% |
| Reference Data | |
| Protein Families | Druggable Genome, Transmembrane |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
