Alpha Fodrin (SPTAN1) Rabbit Polyclonal Antibody

CAT#: TA344294

Rabbit Polyclonal Anti-SPTAN1 Antibody - N-terminal region



Need it in bulk or conjugated?
Get a free quote

CNY 5,200.00


货期*
2周

规格
    • 50 ug

Product images

经常一起买 (3)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Purified recombinant protein of Homo sapiens spectrin, alpha, non-erythrocytic 1 (alpha-fodrin) (SPTAN1), transcript variant 2, 20 µg
    • 20 ug

CNY 2,900.00


Purified recombinant protein of Homo sapiens spectrin, alpha, non-erythrocytic 1 (alpha-fodrin) (SPTAN1), transcript variant 2, 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications IHC, IP, WB
Recommend Dilution WB, IHC, IP
Reactivity Human, Rat, Mouse
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-SPTAN1 antibody: synthetic peptide directed towards the N terminal of human SPTAN1. Synthetic peptide located within the following region: MDPSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQ
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 272 kDa
Gene Name spectrin alpha, non-erythrocytic 1
Background Fodrin (SPTAN1), which seems to be involved in secretion, interacts with calmodulin in a calcium-dependent manner and is thus candidate for the calcium-dependent movement of the cytoskeleton at the membrane.
Synonyms EIEE5; NEAS; SPTA2
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 93%
Reference Data
Protein Families Druggable Genome
Protein Pathways Tight junction
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...