TXNDC4 (ERP44) Rabbit Polyclonal Antibody

CAT#: TA344227

Rabbit Polyclonal Anti-TXNDC4 Antibody - middle region



Need it in bulk or conjugated?
Get a free quote

CNY 4628.00


货期*
2周

规格
    • 50 ug

Product images

推荐一起购买 (4)
Transient overexpression lysate of endoplasmic reticulum protein 44 (ERP44)
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human endoplasmic reticulum protein 44 (ERP44), 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Recombinant protein of human endoplasmic reticulum protein 44 (ERP44), 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-TXNDC4 antibody: synthetic peptide directed towards the middle region of human TXNDC4. Synthetic peptide located within the following region: LHREFHHGPDPTDTAPGEQAQDVASSPPESSFQKLAPSEYRYTLLRDRDE
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 45 kDa
Gene Name endoplasmic reticulum protein 44
Background TXNDC4 mediates thiol-dependent retention in the early secretory pathway, forming mixed disulfides with substrate proteins through its conserved CRFS motif. TXNDC4 inhibits the calcium channel activity of ITPR1. TXNDC4 may have a role in the control of oxidative protein folding in the endoplasmic reticulum. TXNDC4 is required to retain ERO1L and ERO1LB in the endoplasmic reticulum.
Synonyms PDIA10; TXNDC4
Note Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Dog: 86%; Zebrafish: 79%
Reference Data
Protein Families Druggable Genome
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...