Thrombopoietin (THPO) Rabbit Polyclonal Antibody

CAT#: TA344223

Rabbit Polyclonal Anti-THPO Antibody - middle region



Need it in bulk or conjugated?
Get a free quote

CNY 4628.00


货期*
2周

规格
    • 50 ug

Product images

推荐一起购买 (2)
Transient overexpression lysate of thrombopoietin (THPO)
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-THPO antibody: synthetic peptide directed towards the middle region of human THPO. Synthetic peptide located within the following region: NLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTS
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 35 kDa
Gene Name thrombopoietin
Background Megakaryocytopoiesis is the cellular development process that leads to platelet production. THPO is a humoral growth factor that is necessary for megakaryocyte proliferation and maturation, as well as for thrombopoiesis. THPO is the ligand for MLP/C_MPL, the product of myeloproliferative leukemia virus oncogene.Megakaryocytopoiesis is the cellular development process that leads to platelet production. The protein encoded by this gene is a humoral growth factor that is necessary for megakaryocyte proliferation and maturation, as well as for thrombopoiesis. This protein is the ligand for MLP/C_MPL, the product of myeloproliferative leukemia virus oncogene. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Synonyms MGDF; MKCSF; ML; MPLLG; THCYT1; TPO
Note Immunogen Sequence Homology: Human: 100%; Rabbit: 90%; Dog: 83%
Reference Data
Protein Families Druggable Genome, Secreted Protein
Protein Pathways Hematopoietic cell lineage
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...