PAPP A2 (PAPPA2) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PAPPA2 antibody: synthetic peptide directed towards the N terminal of human PAPPA2. Synthetic peptide located within the following region: PPDLTENPAGLRGAVEEPAAPWVGDSPIGQSELLGDDDAYLGNQRSKESL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	92 kDa
Gene Name	pappalysin 2
Database Link	NP_068755 Entrez Gene 60676 Human UniProt ID Q9BXP8
Background	PAPPA2 is a metalloproteinase which specifically cleaves IGFBP-5. It shows limited proteolysis toward IGFBP-3.
Synonyms	PAPP-A2; PAPP-E; PAPPE; PLAC3
Note	Immunogen Sequence Homology: Human: 100%; Rat: 86%; Pig: 85%; Guinea pig: 85%
Reference Data
Protein Families	Protease, Secreted Protein

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.