Plunc (BPIFA1) Rabbit Polyclonal Antibody
CAT#: TA344133
Rabbit Polyclonal Anti-PLUNC Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,200.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 9,998.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommend Dilution | WB, IHC |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-PLUNC antibody: synthetic peptide directed towards the middle region of human PLUNC. Synthetic peptide located within the following region: GLNNIIDIKVTDPQLLELGLVQSPDGHRLYVTIPLGIKLQVNTPLVGASL |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 28 kDa |
Gene Name | BPI fold containing family A member 1 |
Database Link | |
Background | PLUNC is the human homolog of murine plunc and is specifically expressed in the upper airways and nasopharyngeal regions. The exact biological function of this protein is not known, however, it has been suggested to be involved in inflammatory responses to irritants in the upper airways. It may also serve as a potential molecular marker for detection of micrometastasis in non-small-cell lung cancer.This gene is the human homolog of murine plunc, and like the mouse gene, is specifically expressed in the upper airways and nasopharyngeal regions. The exact biological function of this gene is not known, however, it has been suggested to be involved in inflammatory responses to irritants in the upper airways. It may also serve as a potential molecular marker for detection of micrometastasis in non-small-cell lung cancer. Multiple transcript variants resulting from alternative splicing in the 3' UTR have been detected, but the full-length nature of only two is known. |
Synonyms | bA49G10.5; LUNX; NASG; PLUNC; SPLUNC1; SPURT |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 93% |
Reference Data | |
Protein Families | Secreted Protein |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |