GTSE1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-GTSE1 antibody: synthetic peptide directed towards the middle region of human GTSE1. Synthetic peptide located within the following region: IDLMTNTPDMNKNVAKPSPVVGQLIDLSSPLIQLSPEADKENVDSPLLKF
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	76 kDa
Gene Name	G2 and S-phase expressed 1
Database Link	NP_057510 Entrez Gene 51512 Human UniProt ID Q9NYZ3
Background	GTSE1 is only expressed in the S and G2 phases of the cell cycle, where it colocalizes with cytoplasmic tubulin and microtubules. In response to DNA damage, the encoded protein accumulates in the nucleus and binds the tumor suppressor protein p53, shuttling it out of the nucleus and repressing its ability to induce apoptosis.The protein encoded by this gene is only expressed in the S and G2 phases of the cell cycle, where it colocalizes with cytoplasmic tubulin and microtubules. In response to DNA damage, the encoded protein accumulates in the nucleus and binds the tumor suppressor protein p53, shuttling it out of the nucleus and repressing its ability to induce apoptosis.
Synonyms	B99
Note	Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Horse: 93%; Rabbit: 93%; Bovine: 86%; Guinea pig: 86%
Reference Data
Protein Families	Druggable Genome
Protein Pathways	p53 signaling pathway

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.