NSUN6 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-NSUN6 antibody: synthetic peptide directed towards the N terminal of human NSUN6. Synthetic peptide located within the following region: SIFPKISLRPEVENYLKEGFMNKEIVTALGKQEAERKFETLLKHLSHPPS
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	52 kDa
Gene Name	NOP2/Sun RNA methyltransferase family member 6
Database Link	NP_872349 Entrez Gene 221078 Human UniProt ID Q8TEA1
Background	NSUN6 may have S-adenosyl-L-methionine-dependent methyl-transferase activity (Potential). NSUN6 belongs to the methyltransferase superfamily, RsmB/NOP family. It contains 1 PUA domain.Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.
Synonyms	4933414E04Rik; ARL5B-AS1; NOPD1
Note	Immunogen Sequence Homology: Human: 100%; Mouse: 100%; Rabbit: 100%; Dog: 92%; Pig: 92%; Bovine: 92%; Horse: 85%; Guinea pig: 83%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.