NSUN6 Rabbit Polyclonal Antibody
CAT#: TA344028
Rabbit Polyclonal Anti-NSUN6 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-NSUN6 antibody: synthetic peptide directed towards the N terminal of human NSUN6. Synthetic peptide located within the following region: SIFPKISLRPEVENYLKEGFMNKEIVTALGKQEAERKFETLLKHLSHPPS |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 52 kDa |
Gene Name | NOP2/Sun RNA methyltransferase family member 6 |
Database Link | |
Background | NSUN6 may have S-adenosyl-L-methionine-dependent methyl-transferase activity (Potential). NSUN6 belongs to the methyltransferase superfamily, RsmB/NOP family. It contains 1 PUA domain.Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests. |
Synonyms | 4933414E04Rik; ARL5B-AS1; NOPD1 |
Note | Immunogen Sequence Homology: Human: 100%; Mouse: 100%; Rabbit: 100%; Dog: 92%; Pig: 92%; Bovine: 92%; Horse: 85%; Guinea pig: 83% |
Reference Data | |
Protein Families | Druggable Genome |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |