ALKBH8 Rabbit Polyclonal Antibody
CAT#: TA343982
Rabbit Polyclonal Anti-ALKBH8 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4628.00
CNY 3080.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ALKBH8 antibody: synthetic peptide directed towards the N terminal of human ALKBH8. Synthetic peptide located within the following region: MDSNHQSNYKLSKTEKKFLRKQIKAKHTLLRHEGIETVSYATQSLVVANG |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 27 kDa |
Gene Name | alkB homolog 8, tRNA methyltransferase |
Database Link | |
Background | The function remains unknown. |
Synonyms | ABH8; TRM9; TRMT9 |
Note | Immunogen Sequence Homology: Human: 100%; Bovine: 100%; Dog: 93%; Pig: 86%; Horse: 86%; Rat: 79%; Guinea pig: 79% |
Reference Data | |
Protein Families | Druggable Genome |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |