Mbnl2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Mbnl2 antibody is: synthetic peptide directed towards the middle region of RAT Mbnl2. Synthetic peptide located within the following region: IACFDSLKGRCSRENCKYLHPPTHLKTQLEINGRNNLIQQKTAAAMLAQQ
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	41 kDa
Gene Name	muscleblind-like splicing regulator 2
Database Link	NP_001104534 Entrez Gene 680445 Rat UniProt ID F2Z3T4
Background	Mbnl2 mediates pre-mRNA alternative splicing regulation. It acts either as activator or repressor of splicing on specific pre-mRNA targets. It inhibits cardiac troponin-T (TNNT2) pre-mRNA exon inclusion but induces insulin receptor (IR) pre-mRNA exon inclusion in muscle. It antagonizes the alternative splicing activity pattern of CELF proteins. RNA-binding protein that binds to 5'ACACCC-3' core sequence, termed zipcode, within the 3' UTR of ITGA3. It binds to CUG triplet repeat expansion in myotonic dystrophy muscle cells by sequestering the target RNAs. It seems to regulate expression and localization of ITGA3 by transporting it from the nucleus to cytoplasm at adhesion plaques. It may play a role in myotonic dystrophy pathophysiology (DM).
Synonyms	DKFZp781H1296; MBLL; MBLL39; MGC120625; MGC120626; MGC120628; MLP1; OTTHUMP00000178763; PRO2032
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.