CWC22 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-KIAA1604 antibody: synthetic peptide directed towards the C terminal of human KIAA1604. Synthetic peptide located within the following region: RSKSKEMNRKHSGSRSDEDRYQNGAERRWEKSSRYSEQSRESKKNQDRRR
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	105 kDa
Gene Name	CWC22 homolog, spliceosome-associated protein
Database Link	NP_065994 Entrez Gene 57703 Human UniProt ID Q9HCG8
Background	KIAA1604 may be involved in pre-mRNA splicing.
Synonyms	EIF4GL; fSAPb; NCM
Note	Immunogen Sequence Homology: Pig: 100%; Human: 100%; Horse: 93%; Dog: 86%; Bovine: 86%; Guinea pig: 86%; Rat: 83%; Mouse: 83%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.