RBM28 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Rbm28 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Rbm28. Synthetic peptide located within the following region: QKKQQLASSVQAPKRKAKENKAEARFNQLVEQYKQKLLGPSKGAPLMKRS
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	65 kDa
Gene Name	RNA binding motif protein 28
Database Link	NP_060547 Entrez Gene 68272 Mouse UniProt ID Q9NW13
Background	Rbm28 is a nucleolar component of the spliceosomal ribonucleoprotein complexes.
Synonyms	ANES
Note	Immunogen Sequence Homology: Human: 93%; Dog: 86%; Horse: 86%; Mouse: 86%; Bovine: 86%; Pig: 79%; Guinea pig: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.