NIP7 Rabbit Polyclonal Antibody
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-NIP7 antibody: synthetic peptide directed towards the middle region of human NIP7. Synthetic peptide located within the following region: PGAEQSFLYGNHVLKSGLGRITENTSQYQGVVVYSMADIPLGFGVAAKST |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 20 kDa |
Gene Name | NIP7, nucleolar pre-rRNA processing protein |
Database Link | |
Background | NIP7 contains 1PUA domain and belongs to the NIP7 family. It may play a role in 60S ribosomal subunit synthesis. |
Synonyms | CGI-37; HSPC031; KD93 |
Note | Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Dog: 93%; Rabbit: 93%; Guinea pig: 93%; Zebrafish: 86% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |