EXOSC3 Rabbit Polyclonal Antibody
CAT#: TA343836
Rabbit Polyclonal Anti-EXOSC3 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommend Dilution | WB, IHC |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-EXOSC3 antibody: synthetic peptide directed towards the C terminal of human EXOSC3. Synthetic peptide located within the following region: PLEIVFGMNGRIWVKAKTIQQTLILANILEACEHMTSDQRKQIFSRLAES |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 30 kDa |
Gene Name | exosome component 3 |
Database Link | |
Background | EXOSC3 is component of the exosome 3'->5' exoribonuclease complex and is required for the 3' processing of the 7S pre-RNA to the mature 5.8S rRNA. |
Synonyms | bA3J10.7; CGI-102; hRrp-40; p10; PCH1B; RRP40; Rrp40p |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Rat: 92%; Mouse: 85%; Guinea pig: 85% |
Reference Data | |
Protein Families | Stem cell - Pluripotency |
Protein Pathways | RNA degradation |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |