CSTF2T Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CSTF2T antibody: synthetic peptide directed towards the C terminal of human CSTF2T. Synthetic peptide located within the following region: AGIQGGGMQGAGIQGVSIQGGGIQGGGIQGASKQGGSQPSSFSPGQSQVT
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	64 kDa
Gene Name	cleavage stimulation factor subunit 2, tau variant
Database Link	NP_056050 Entrez Gene 23283 Human UniProt ID Q9H0L4
Background	CSTF2T may play a significant role in AAUAAA-independent mRNA polyadenylation in germ cells. It is directly involved in the binding to pre-mRNAs.
Synonyms	CstF-64T
Note	Immunogen Sequence Homology: Human: 100%; Mouse: 93%; Dog: 86%; Pig: 86%; Rat: 86%; Horse: 86%; Bovine: 86%; Guinea pig: 86%; Rabbit: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.