CSTF2T Rabbit Polyclonal Antibody
CAT#: TA343826
Rabbit Polyclonal Anti-CSTF2T Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-CSTF2T antibody: synthetic peptide directed towards the C terminal of human CSTF2T. Synthetic peptide located within the following region: AGIQGGGMQGAGIQGVSIQGGGIQGGGIQGASKQGGSQPSSFSPGQSQVT |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 64 kDa |
Gene Name | cleavage stimulation factor subunit 2, tau variant |
Database Link | |
Background | CSTF2T may play a significant role in AAUAAA-independent mRNA polyadenylation in germ cells. It is directly involved in the binding to pre-mRNAs. |
Synonyms | CstF-64T |
Note | Immunogen Sequence Homology: Human: 100%; Mouse: 93%; Dog: 86%; Pig: 86%; Rat: 86%; Horse: 86%; Bovine: 86%; Guinea pig: 86%; Rabbit: 79% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |