Larp4b Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Larp4b antibody is: synthetic peptide directed towards the middle region of Mouse Larp4b. Synthetic peptide located within the following region: ENNDTGGNESQPESQEDPREVLKKTLEFCLSRENLASDMYLISQMDSDQY
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	81 kDa
Gene Name	La ribonucleoprotein domain family, member 4B
Database Link	NP_766173 Entrez Gene 217980 Mouse UniProt ID Q6A0A2
Background	The function of this protein remains unknown.
Synonyms	DKFZp686M23113; KIAA0217; LARP5
Note	Immunogen Sequence Homology: Human: 100%; Horse: 93%; Rat: 92%; Pig: 86%; Rabbit: 86%; Mouse: 85%; Bovine: 85%; Guinea pig: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.