TMEM63A Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TMEM63A antibody: synthetic peptide directed towards the N terminal of human TMEM63A. Synthetic peptide located within the following region: MDSPFLELWQSKAVSIREQLGLGDRPNDSYCYNSAKNSTVLQGVTFGGIP
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	89 kDa
Gene Name	transmembrane protein 63A
Database Link	NP_055513 Entrez Gene 9725 Human UniProt ID O94886
Background	TMEM63A is a multi-pass membrane proteinPotential. It belongs to the SPO75/TMEM63 family. The exact function of TMEM63A remains unknown.
Synonyms	KIAA0792
Note	Immunogen Sequence Homology: Human: 100%; Rat: 93%; Pig: 86%; Mouse: 86%; Rabbit: 86%; Guinea pig: 86%; Yeast: 83%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.