TOX4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-TOX4 antibody is: synthetic peptide directed towards the C-terminal region of Human TOX4. Synthetic peptide located within the following region: RCVRSGCENPPIVSKDWDNEYCSNECVVKHCRDVFLAWVASRNSNTVVFV
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	65 kDa
Gene Name	TOX high mobility group box family member 4
Database Link	NP_055643 Entrez Gene 9878 Human UniProt ID O94842
Background	The function of this protein remains unknown.
Synonyms	C14orf92; KIAA0737; LCP1; MIG7
Note	Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Goat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Rat: 86%; Zebrafish: 77%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.