zinc finger protein 112 (ZNF112) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZNF228 antibody: synthetic peptide directed towards the N terminal of human ZNF228. Synthetic peptide located within the following region: VTFKDVAVVFTEEELGLLDSVQRKLYRDVMLENFRNLLLVAHQPFKPDLI
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	105 kDa
Gene Name	zinc finger protein 112
Database Link	NP_037512 Entrez Gene 7771 Human UniProt ID Q9UJU3
Background	ZNF228 contains 1 KRAB domain. The function of ZNF228 remains unknown.
Synonyms	ZFP112; ZNF228
Note	Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Bovine: 93%; Horse: 92%; Mouse: 85%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.