KAT6B Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-MYST4 antibody: synthetic peptide directed towards the N terminal of human MYST4. Synthetic peptide located within the following region: MVKLANPLYTEWILEAIQKIKKQKQRPSEERICHAVSTSHGLDKKTVSEQ
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	231 kDa
Gene Name	lysine acetyltransferase 6B
Database Link	NP_001243397 Entrez Gene 23522 Human UniProt ID Q8WYB5
Background	MYST4 is a histone acetyltransferase which may be involved in both positive and negative regulation of transcription. It is required for RUNX2-dependent transcriptional activation and May be involved in cerebral cortex development.
Synonyms	GTPTS; MORF; MOZ2; MYST4; qkf; querkopf; ZC2HC6B
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.