HEY2 Rabbit Polyclonal Antibody
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-HEY2 antibody: synthetic peptide directed towards the middle region of human HEY2. Synthetic peptide located within the following region: PMLPPNAAAAVAAATAISPPLSVSATSSPQQTSSGTNNKPYRPWGTEVGA |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 36 kDa |
Gene Name | hes related family bHLH transcription factor with YRPW motif 2 |
Database Link | |
Background | HEY2 is a member of the hairy and enhancer of split-related (HESR) family of basic helix-loop-helix (bHLH)-type transcription factors. HEY2 forms homo- or hetero-dimers that localize to the nucleus and interact with a histone deacetylase complex to repres |
Synonyms | bHLHb32; CHF1; GRIDLOCK; GRL; HERP1; HESR2; HRT2 |
Note | Immunogen Sequence Homology: Pig: 100%; Human: 100%; Guinea pig: 100%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Dog: 90%; Rabbit: 90%; Zebrafish: 86% |
Reference Data | |
Protein Families | Druggable Genome, Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |