CDKN1A interacting zinc finger protein 1 (CIZ1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CIZ1 antibody: synthetic peptide directed towards the C terminal of human CIZ1. Synthetic peptide located within the following region: YKAAKNPSPTTRPVSRRCAINARNALTALFTSSGRPPSQPNTQDKTPSKV
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	100 kDa
Gene Name	CDKN1A interacting zinc finger protein 1
Database Link	NP_036259 Entrez Gene 25792 Human UniProt ID Q9ULV3
Background	CIZ1 may regulate the subcellular localization of CIP/WAF1.
Synonyms	LSFR1; NP94; ZNF356
Note	Immunogen Sequence Homology: Human: 100%; Horse: 77%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.