GTF3C5 Rabbit Polyclonal Antibody
CAT#: TA343678
Rabbit Polyclonal Anti-GTF3C5 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 3080.00
CNY 9998.00
CNY 3080.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommend Dilution | WB, IHC |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-GTF3C5 antibody: synthetic peptide directed towards the C terminal of human GTF3C5. Synthetic peptide located within the following region: SKRPALFSSSAKADGGKEQLTYESGEDEEDEEEEEEEEEDFKPSDGSENE |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 60 kDa |
Gene Name | general transcription factor IIIC subunit 5 |
Database Link | |
Background | GTF3C5 is polypeptide 5 of general transcription factor IIIon Channel. Human transcription factor IIIon Channel (hTFIIIon Channel) is a multisubunit complex that directly recognizes promoter elements and recruits TFIIIB and RNA polymerase III. |
Synonyms | TFiiiC2-63; TFIIIC63; TFIIICepsilon |
Note | Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Bovine: 93%; Rabbit: 93%; Pig: 77%; Guinea pig: 77% |
Reference Data | |
Protein Families | Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |