ZNF185 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZNF185 antibody: synthetic peptide directed towards the N terminal of human ZNF185. Synthetic peptide located within the following region: LAPYNIRRSSTSGDTEEEEEEEVVPFSSDEQKRRSEAASGVLRRTAPREH
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	73 kDa
Gene Name	zinc finger protein 185 (LIM domain)
Database Link	NP_009081 Entrez Gene 7739 Human UniProt ID O15231
Background	ZNF185 contains 1 LIM zinc-binding domain. The function of ZNF185 remains unknown.ZNF185 encodes a LIM-domain zinc finger protein. These proteins are thought to be involved in protein-protein interactions. [supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1276 AY997296.1 1-1276 1277-4307 AK056517.1 347-3377 4308-4312 BQ923456.1 628-632
Synonyms	SCELL
Note	Immunogen Sequence Homology: Human: 100%; Mouse: 86%; Horse: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.