SOX15 Rabbit Polyclonal Antibody
CAT#: TA343646
Rabbit Polyclonal Anti-SOX15 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4537.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommend Dilution | WB, IHC |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-SOX15 antibody: synthetic peptide directed towards the middle region of human SOX15. Synthetic peptide located within the following region: ASGGPLWGPGYATTQPSRGFGYRPPSYSTAYLPGSYGSSHCKLEAPSPCS |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 25 kDa |
Gene Name | SRY-box 15 |
Database Link | |
Background | SOX15 is a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The protein may act as a transcriptional regulator after forming a protein complex with other proteins.This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. |
Synonyms | SOX20; SOX26; SOX27 |
Note | Immunogen Sequence Homology: Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Guinea pig: 100%; Dog: 93%; Mouse: 93%; Rat: 86% |
Reference Data | |
Protein Families | Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |