Kaiso (ZBTB33) Rabbit Polyclonal Antibody

CAT#: TA343638

Rabbit Polyclonal Anti-ZBTB33 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5250.00


货期*
6周

规格
    • 100 ul

Product images

推荐一起购买 (3)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Transient overexpression lysate of zinc finger and BTB domain containing 33 (ZBTB33), transcript variant 1
    • 100 ug

CNY 4840.00


Transient overexpression lysate of zinc finger and BTB domain containing 33 (ZBTB33)
    • 100 ug

CNY 3080.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-ZBTB33 antibody: synthetic peptide directed towards the N terminal of human ZBTB33. Synthetic peptide located within the following region: MESRKLISATDIQYSGSLLNSLNEQRGHGLFCDVTVIVEDRKFRAHKNIL
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 74 kDa
Gene Name zinc finger and BTB domain containing 33
Background ZBTB33 is a transcriptional regulator with bimodal DNA-binding specificity. ZBTB33 binds to methylated CpG dinucleotides in the consensus sequence 5'-CGCG-3' and also binds to the non-methylated consensus sequence 5'-CTGCNA-3'. ZBTB33 recruits the N-CoR repressor complex to promote histone deacetylation and the formation of repressive chromatin structures in target gene promoters. It may contribute to the repression of target genes of the Wnt signaling pathway. It may also activate transcription of a subset of target genes by the recruitment of CTNND2.
Synonyms ZNF-kaiso; ZNF348
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Guinea pig: 100%; Mouse: 93%; Rabbit: 93%
Reference Data
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...