LZTR1 Rabbit Polyclonal Antibody
CAT#: TA343636
Rabbit Polyclonal Anti-LZTR1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
| Product Data | |
| Applications | WB |
| Recommend Dilution | WB |
| Reactivity | Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-LZTR1 antibody: synthetic peptide directed towards the N terminal of human LZTR1. Synthetic peptide located within the following region: AGPGSTGGQIGAAALAGGARSKVAPSVDFDHSCSDSVEYLTLNFGPFETV |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 95 kDa |
| Gene Name | leucine-zipper-like transcription regulator 1 |
| Database Link | |
| Background | Leucine-zipper-like transcriptional regulator 1(LZTR1) is belived to be a DNA-binding protein and transcriptional regulator based on its predicted structural characteristics. The transcript is present in several essential fetal organs and is hemizygously deleted in some DiGeorge syndrome patients. LZTR1 is thought to play a critical role in embryogenesis.This gene encodes a member of the BTB-kelch superfamily. Initially described as a putative transcriptional regulator based on weak homology to members of the basic leucine zipper-like family, the encoded protein subsequently has been shown to localize exclusively to the Golgi network where it may help stabilize the Gogli complex. Deletion of this gene may be associated with DiGeorge syndrome. |
| Synonyms | BTBD29; LZTR-1; NS10; SWNTS2 |
| Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100% |
| Reference Data | |
| Protein Families | Transcription Factors |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
