TSG101 Rabbit Polyclonal Antibody
CAT#: TA343598
Rabbit Polyclonal Anti-TSG101 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
货期*
6周
规格
Cited in 3 publications. |
推荐一起购买 (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human, Rat |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-TSG101 antibody: synthetic peptide directed towards the C terminal of human TSG101. Synthetic peptide located within the following region: TIFYLGEALRRGVIDLDVFLKHVRLLSRKQFQLRALMQKARKTAGLSDLY |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 44 kDa |
Gene Name | tumor susceptibility 101 |
Database Link | |
Background | TSG101 belongs to a group of apparently inactive homologs of ubiquitin-conjugating enzymes. TSG101 contains a coiled-coil domain that interacts with stathmin, a cytosolic phosphoprotein implicated in tumorigenesis. TSG101 may play a role in cell growth and differentiation and act as a negative growth regulator. In vitro steady-state expression of TSG101 appears to be important for maintenance of genomic stability and cell cycle regulation. Mutations and alternative splicing in TSG101 gene occur in high frequency in breast cancer. The protein encoded by this gene belongs to a group of apparently inactive homologs of ubiquitin-conjugating enzymes. The gene product contains a coiled-coil domain that interacts with stathmin, a cytosolic phosphoprotein implicated in tumorigenesis. The protein may play a role in cell growth and differentiation and act as a negative growth regulator. In vitro steady-state expression of this tumor susceptibility gene appears to be important for maintenance of genomic stability and cell cycle regulation. Mutations and alternative splicing in this gene occur in high frequency in breast cancer and suggest that defects occur during breast cancer tumorigenesis and/or progression. |
Synonyms | TSG10; VPS23 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100% |
Reference Data | |
Protein Families | Druggable Genome, Transcription Factors |
Protein Pathways | Endocytosis |
Citations (3)
The use of this Antibodies has been cited in the following citations: |
---|
Involvement of extracellular vesicles in the macrophage-tumor cell communication in head and neck squamous cell carcinoma
,Bellmunt, ÀM;López-Puerto, L;Lorente, J;Closa, D;,
PLoS ONE
,PubMed ID 31697737
[TSG101]
|
Evaluation of serum extracellular vesicle isolation methods for profiling miRNAs by next-generation sequencing
,Buschmann, D;Kirchner, B;Hermann, S;Märte, M;Wurmser, C;Brandes, F;Kotschote, S;Bonin, M;Steinlein, OK;Pfaffl, MW;Schelling, G;Reithmair, M;,
J Extracell Vesicles
,PubMed ID 29887978
[TSG101]
|
Cellular and extracellular miRNAs are blood-compartment-specific diagnostic targets in sepsis
,Reithmair, M;Buschmann, D;Märte, M;Kirchner, B;Hagl, D;Kaufmann, I;Pfob, M;Chouker, A;Steinlein, OK;Pfaffl, MW;Schelling, G;,
J. Cell. Mol. Med.
,PubMed ID 28382754
[TSG101]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |
Customer
Reviews
Loading...