ETS2 Rabbit Polyclonal Antibody

CAT#: TA343521

Rabbit Polyclonal Anti-ETS2 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4628.00


货期*
2周

规格
    • 50 ug

Product images

推荐一起购买 (2)
Transient overexpression lysate of v-ets erythroblastosis virus E26 oncogene homolog 2 (avian) (ETS2)
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human, Mouse
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-ETS2 antibody: synthetic peptide directed towards the middle region of human ETS2. Synthetic peptide located within the following region: DPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTSGKRYVYRFVC
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 53 kDa
Gene Name ETS proto-oncogene 2, transcription factor
Background ETS2 contains an ETS DNA-binding domain and belongs to the ETS family. ETS2 is a target of protein kinase C and upregulates GM-CSF. Ets2 and its targets play essential roles in endothelial cell function. Coexpression of Ets-2 and SRC-1 significantly associated with the rate of recurrence and HER expression in breast cancer. Overexpression of ETS2 is associated with human esophageal squamous cell carcinoma. ETS transcriptions factors, such as ETS2, regulate numerous genes and are involved in stem cell development, cell senescence and death, and tumorigenesis. The conserved ETS domain within these proteins is a winged helix-turn-helix DNA-binding domain that recognizes the core consensus DNA sequence GGAA/T of target genes (Dwyer et al., 2007 [PubMed 17986575]). [supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Synonyms ETS2IT1
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%
Reference Data
Protein Families Druggable Genome, Transcription Factors
Protein Pathways Dorso-ventral axis formation
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...