NR1D2 Rabbit Polyclonal Antibody

CAT#: TA343508

Rabbit Polyclonal Anti-NR1D2 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5250.00


货期*
6周

规格
    • 100 ul

Product images

推荐一起购买 (4)
Transient overexpression lysate of nuclear receptor subfamily 1, group D, member 2 (NR1D2), transcript variant 1
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human nuclear receptor subfamily 1, group D, member 2 (NR1D2), transcript variant 1, 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Recombinant protein of human nuclear receptor subfamily 1, group D, member 2 (NR1D2), transcript variant 1, 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-NR1D2 antibody: synthetic peptide directed towards the C terminal of human NR1D2. Synthetic peptide located within the following region: ETLIRALRTLIMKNHPNEASIFTKLLLKLPDLRSLNNMHSEELLAFKVHP
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Protein A purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 65 kDa
Gene Name nuclear receptor subfamily 1 group D member 2
Background NR1D2 can interact with NCOA5 coactivator, leading to a strong increase of transcription of target genes. NR1D2 also binds to the sequences 5'-AATGTAGGTCA-3' and 5'-ATAACTAGGTCA-3' and acts as a potent competitive transcriptional silencer and negative regulator of RORalpha mediated trans-activation. NR1D2 may play different roles in metabolism, inflammation, and circadian cycling in the organ-specific manner in homeostasis.
Synonyms BD73; EAR-1R; RVR
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%; Sheep: 92%
Reference Data
Protein Families Druggable Genome, Nuclear Hormone Receptor, Transcription Factors
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...