ZNF205 Rabbit Polyclonal Antibody
CAT#: TA343409
Rabbit Polyclonal Anti-ZNF205 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ZNF205 antibody: synthetic peptide directed towards the N terminal of human ZNF205. Synthetic peptide located within the following region: PSKLGEAVPSGDTQESLHIKMEPEEPHSEGASQEDGAQGAWGWAPLSHGS |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 61 kDa |
Gene Name | zinc finger protein 205 |
Database Link | |
Background | ZNF205 may be involved in transcriptional regulation. |
Synonyms | RhitH; Zfp13; ZNF210 |
Note | Immunogen Sequence Homology: Human: 100%; Mouse: 93%; Rat: 86%; Bovine: 85%; Dog: 79%; Pig: 79%; Guinea pig: 79% |
Reference Data | |
Protein Families | Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |