ZNF133 Rabbit Polyclonal Antibody
CAT#: TA343397
Rabbit Polyclonal Anti-ZNF133 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | IF, WB |
Recommend Dilution | WB, IF |
Reactivity | Human, Mouse |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ZNF133 antibody: synthetic peptide directed towards the middle region of human ZNF133. Synthetic peptide located within the following region: KPYVCKTCGRGFSLKSHLSRHRKTTSVHHRLPVQPDPEPCAGQPSDSLYS |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 73 kDa |
Gene Name | zinc finger protein 133 |
Database Link | |
Background | ZNF193 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 5 C2H2-type zinc fingers and 1 SCAN box domain. ZNF193 may be involved in transcriptional regulation. |
Synonyms | pHZ-13; pHZ-66; ZNF150 |
Note | Immunogen Sequence Homology: Human: 100%; Pig: 77%; Rabbit: 77% |
Reference Data | |
Protein Families | Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |