ZNF74 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-ZNF74 antibody is: synthetic peptide directed towards the N-terminal region of Human ZNF74. Synthetic peptide located within the following region: VISHLERGEEPWSMQREVPRGPCPEWELKAVPSQQQGICKEEPAQEPIME
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	63 kDa
Gene Name	zinc finger protein 74
Database Link	NP_003417 Entrez Gene 7625 Human UniProt ID Q16587
Background	ZNF74 contains 1 KRAB domain. The exact function of ZNF74 is not known.
Synonyms	COS52; hZNF7; ZFP520; ZNF520
Note	Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Dog: 91%; Rabbit: 90%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.