AP2 beta (TFAP2B) Rabbit Polyclonal Antibody
CAT#: TA343377
Rabbit Polyclonal Anti-TFAP2B Antibody
Need it in bulk or conjugated? 
                            Get a free quote
                        
CNY 4628.00
                                                
                                                
                                                
                                                    CNY 300.00 
                                                    
                                                    CNY 1430.00
                                                
                                            
Specifications
| Product Data | |
| Applications | WB | 
| Recommend Dilution | WB | 
| Reactivity | Human, Mouse | 
| Host | Rabbit | 
| Clonality | Polyclonal | 
| Immunogen | The immunogen for anti-TFAP2B antibody: synthetic peptide directed towards the N terminal of human TFAP2B. Synthetic peptide located within the following region: MHSPPRDQAAIMLWKLVENVKYEDIYEDRHDGVPSHSSRLSQLGSVSQGP | 
| Isotype | IgG | 
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.  | 
        
| Purification | Affinity Purified | 
| Conjugation | Unconjugated | 
| Storage Condition | Store at -20°C as received. | 
| Predicted Protein Size | 50 kDa | 
| Gene Name | transcription factor AP-2 beta | 
| Database Link | |
| Background | TFAP2B belongs to the AP-2 family which is developmentally regulated and have distinct overlapping functions in the regulation of many genes governing growth and differentiation. TFAP2B binds DNA as a dimmer and can form homodimers or heterodimers with other AP-2 family members. It may be a candidate for conferring susceptibility to type 2 didabetes. | 
| Synonyms | AP-2B; AP2-B | 
| Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 100%; Guinea pig: 80% | 
| Reference Data | |
| Protein Families | Druggable Genome, Transcription Factors | 
Documents
| Product Manuals | 
| FAQs | 
| SDS | 
Resources
| 抗体相关资料 | 
其它AP2 beta产品
