SFTPA1 Rabbit Polyclonal Antibody
CAT#: TA343345
Rabbit Polyclonal Anti-SFTPA1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5200.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 3080.00
CNY 9998.00
CNY 3080.00
Specifications
| Product Data | |
| Applications | WB |
| Recommend Dilution | WB |
| Reactivity | Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-SFTPA1 antibody is: synthetic peptide directed towards the C-terminal region of Human SFTPA1. Synthetic peptide located within the following region: KYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYT |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 20 kDa |
| Gene Name | surfactant protein A1 |
| Database Link | |
| Background | The function of this protein remains unknown. |
| Synonyms | COLEC4; PSAP; PSP-A; PSPA; SFTP1; SFTPA1B; SP-A; SP-A1; SPA; SPA1 |
| Note | Immunogen Sequence Homology: Human: 100%; Dog: 92%; Pig: 85%; Horse: 85%; Mouse: 85%; Sheep: 85%; Bovine: 85% |
| Reference Data | |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
