IDUA Rabbit Polyclonal Antibody
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
| Product Data | |
| Applications | WB |
| Recommend Dilution | WB |
| Reactivity | Mouse |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-Idua antibody is: synthetic peptide directed towards the middle region of MOUSE Idua. Synthetic peptide located within the following region: MENQLLPGFELMGSPSGYFTDFDDKQQVFEWKDLVSLLARRYIGRYGLTH |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 30 kDa |
| Gene Name | iduronidase, alpha-L- |
| Database Link | |
| Background | The function of this protein remains unknown. |
| Synonyms | IDA; MPS1 |
| Note | Immunogen Sequence Homology: Pig: 100%; Horse: 100%; Human: 100%; Guinea pig: 100%; Rat: 93%; Dog: 90%; Mouse: 86%; Bovine: 86% |
| Reference Data | |
| Protein Families | Druggable Genome |
| Protein Pathways | Glycosaminoglycan degradation, Lysosome, Metabolic pathways |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
