GRB 14 (GRB14) Rabbit Polyclonal Antibody
CAT#: TA343322
Rabbit Polyclonal Anti-GRB14 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4628.00
CNY 4840.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Rat |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-Grb14 antibody is: synthetic peptide directed towards the middle region of Rat Grb14. Synthetic peptide located within the following region: KAYFFLRRSGLYFSTKGTSKEPRHLQFFSEFSTSNVYMSLAGKKKHGAPT |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 59 kDa |
Gene Name | growth factor receptor bound protein 14 |
Database Link | |
Background | Grb14 is a member of the Grb7 subfamily of adapters; It functions as inhibitor in insulin-mediated pathways. |
Synonyms | growth factor receptor-bound protein 14 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%; Zebrafish: 86%; Goat: 85% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |