GRB 14 (GRB14) Rabbit Polyclonal Antibody
CAT#: TA343322
Rabbit Polyclonal Anti-GRB14 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4628.00
CNY 4840.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
| Product Data | |
| Applications | WB |
| Recommend Dilution | WB |
| Reactivity | Rat |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-Grb14 antibody is: synthetic peptide directed towards the middle region of Rat Grb14. Synthetic peptide located within the following region: KAYFFLRRSGLYFSTKGTSKEPRHLQFFSEFSTSNVYMSLAGKKKHGAPT |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 59 kDa |
| Gene Name | growth factor receptor bound protein 14 |
| Database Link | |
| Background | Grb14 is a member of the Grb7 subfamily of adapters; It functions as inhibitor in insulin-mediated pathways. |
| Synonyms | growth factor receptor-bound protein 14 |
| Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%; Zebrafish: 86%; Goat: 85% |
| Reference Data | |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
