MC1 Receptor (MC1R) Rabbit Polyclonal Antibody
CNY 5250.00
Cited in 1 publication. |
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-MC1R antibody is: synthetic peptide directed towards the C-terminal region of MC1R. Synthetic peptide located within the following region: CPEHPTCGCIFKNFNLFLALIICNAIIDPLIYAFHSQELRRTLKEVLTCS |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 35 kDa |
Gene Name | melanocortin 1 receptor |
Database Link | |
Background | This intronless gene encodes the receptor protein for melanocyte-stimulating hormone (MSH). The encoded protein, a seven pass transmembrane G protein coupled receptor, controls melanogenesis. Two types of melanin exist: red pheomelanin and black eumelanin. Gene mutations that lead to a loss in function are associated with increased pheomelanin production, which leads to lighter skin and hair color. Eumelanin is photoprotective but pheomelanin may contribute to UV-induced skin damage by generating free radicals upon UV radiation. Binding of MSH to its receptor activates the receptor and stimulates eumelanin synthesis. This receptor is a major determining factor in sun sensitivity and is a genetic risk factor for melanoma and non-melanoma skin cancer. Over 30 variant alleles have been identified which correlate with skin and hair color, providing evidence that this gene is an important component in determining normal human pigment variation. |
Synonyms | CMM5; MSH-R; SHEP2 |
Note | Immunogen Sequence Homology: Human: 100%; Pig: 93%; Rat: 93%; Rabbit: 93%; Mouse: 86% |
Reference Data | |
Protein Families | Druggable Genome, GPCR, Transmembrane |
Protein Pathways | Melanogenesis, Neuroactive ligand-receptor interaction |
Citations (1)
The use of this Antibodies has been cited in the following citations: |
---|
Melanocortin-1 Receptor Positively Regulates Human Artery Endothelial Cell Migration.
,null,
Cellular physiology and biochemistry : international journal of experimental cellular physiology, biochemistry, and pharmacology
,PubMed ID 31050282
[MC1R]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |
其它MC1 Receptor产品