UBE2Z Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Ube2z antibody is: synthetic peptide directed towards the C-terminal region of Rat Ube2z. Synthetic peptide located within the following region: ISSVLISIQSLMTENPYHNEPGFEQERHPGDSKNYNECIRHETIRVAVCD
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	39 kDa
Gene Name	ubiquitin conjugating enzyme E2 Z
Database Link	NP_075567 Entrez Gene 303478 Rat UniProt ID Q9H832
Background	Ube2z catalyzes the covalent attachment of ubiquitin to other proteins. It is a specific substrate for UBA6, not charged with ubiquitin by UBE1 and may be involved in apoptosis regulation.
Synonyms	HOYS7; USE1
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%
Reference Data
Protein Pathways	Acute myeloid leukemia, Pathways in cancer, Ubiquitin mediated proteolysis

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.