NUPL1 (NUP58) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Nupl1 antibody is: synthetic peptide directed towards the middle region of Rat Nupl1. Synthetic peptide located within the following region: GGIDFSTSSDKKSDKTGTRPEDSKALKDENLPPVICQDVENLQKFVKEQK
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	64 kDa
Gene Name	nucleoporin 58kDa
Database Link	NP_054808 Entrez Gene 245922 Rat UniProt ID Q9BVL2
Background	Alternative splice products p58 and p45 are O-linked glycoprotein components of the nuclear pore p62 complex and may play a role in nuclear protein import.
Synonyms	NUP45; NUPL1; PRO2463
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.