BAAT1 (BRAT1) Rabbit Polyclonal Antibody

CAT#: TA343238

Rabbit Polyclonal Anti-BRAT1 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5250.00


货期*
6周

规格
    • 100 ul

Product images

推荐一起购买 (4)
Transient overexpression lysate of chromosome 7 open reading frame 27 (C7orf27)
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human chromosome 7 open reading frame 27 (C7orf27), 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Recombinant protein of human chromosome 7 open reading frame 27 (C7orf27), 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-BRAT1 antibody is: synthetic peptide directed towards the C-terminal region of Human BRAT1. Synthetic peptide located within the following region: FDCDRPVAQKSCDLLLFLRDKIASYSSLREARGSPNTASAEATLPRWRAG
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 87 kDa
Gene Name BRCA1 associated ATM activator 1
Background The protein encoded by this ubiquitously expressed gene interacts with the tumor suppressing BRCA1 (breast cancer 1) protein and and the ATM (ataxia telangiectasia mutated) protein. ATM is thought to be a master controller of cell cycle checkpoint signalling pathways that are required for cellular responses to DNA damage such as double-strand breaks that are induced by ionizing radiation and complexes with BRCA1 in the multi-protein complex BASC (BRAC1-associated genome surveillance complex). The protein encoded by this gene is thought to play a role in the DNA damage pathway regulated by BRCA1 and ATM.
Synonyms BAAT1; C7orf27; RMFSL
Note Immunogen Sequence Homology: Human: 100%
Reference Data
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...