TTLL1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TTLL1 antibody is: synthetic peptide directed towards the C-terminal region of Human TTLL1. Synthetic peptide located within the following region: PNGEIPDCKWNKSPPKEVLGNYEILYDEELAQGDGADRELRSRQGQSLGP
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	43 kDa
Gene Name	tubulin tyrosine ligase like 1
Database Link	NP_036395 Entrez Gene 25809 Human UniProt ID O95922
Background	TTLL1 catalytic subunit of the neuronal tubulin polyglutamylase complex. Modifies alpha- and beta-tubulin, generating side chains of glutamate on the gamma-carboxyl groups of specific glutamate residues within the C-terminal tail of alpha- and beta-tubulin.
Synonyms	C22orf7; HS323M22B
Note	Immunogen Sequence Homology: Dog: 100%; Human: 100%; Horse: 93%; Rat: 92%; Pig: 86%; Bovine: 86%; Rabbit: 85%; Guinea pig: 85%; Mouse
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.