Kifbp Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Kbp antibody is: synthetic peptide directed towards the N-terminal region of Mouse Kbp. Synthetic peptide located within the following region: RVELHKNPEKEPYKSKYGARALLEEVRALLGPAPEDEDEPAADDGPGDQA
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	43 kDa
Gene Name	KIF1 binding protein
Database Link	NP_082473 Entrez Gene 72320 Mouse UniProt ID Q6ZPU9
Background	Kbp is required for organization of axonal microtubules, and axonal outgrowth and maintenance during peripheral and central nervous system development. It regulates mitochondrial transport by modulating KIF1B motor activity.
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.