PTER Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PTER antibody: synthetic peptide directed towards the N terminal of human PTER. Synthetic peptide located within the following region: NAYSHKENLQLNQETEAIKEELLYFKANGGGALVENTTTGISRDTQTLKR
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	38 kDa
Gene Name	phosphotriesterase related
Database Link	NP_109589 Entrez Gene 9317 Human UniProt ID Q96BW5
Background	The function of this protein remains unknown.
Synonyms	HPHRP; RPR-1
Note	Immunogen Sequence Homology: Pig: 100%; Human: 100%; Mouse: 93%; Dog: 92%; Horse: 92%; Bovine: 92%; Rat: 86%; Rabbit: 85%; Guinea pig
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.